PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009103332.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family Nin-like
Protein Properties Length: 775aa    MW: 86886.9 Da    PI: 5.5122
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009103332.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK92.82.5e-29507557252
          RWP-RK   2 ekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                      k+i+l++l++yF++++kdAAk++gvc+T+LKriCRq+GI+RWP+Rkik++
  XP_009103332.1 507 DKNITLDVLRQYFAGSLKDAAKSIGVCPTTLKRICRQHGIQRWPSRKIKKV 557
                     69***********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151916.733496577IPR003035RWP-RK domain
PfamPF020421.2E-25509557IPR003035RWP-RK domain
SuperFamilySSF542775.64E-22668761No hitNo description
Gene3DG3DSA:3.10.20.2403.4E-21674753No hitNo description
SMARTSM006664.1E-25675758IPR000270PB1 domain
PROSITE profilePS5174528.821675758IPR000270PB1 domain
CDDcd064072.92E-42676756No hitNo description
PfamPF005641.6E-18676757IPR000270PB1 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 775 aa     Download sequence    Send to blast
MEDSYLQTEN AVMDTGFMDG LLLDGCWLET TDGSDFLNLT SFNPSSFTWS PTQDTSALLS  60
HMYSQDYAER SSLEEFQWNK RWWIGPGGGA SSVTERLVQA VEHIKDYTTE RGSLIQLWVP  120
VSRGGKRVLT TKEQPFSHDP LCQRLANYRE ISVNYHFSAE QDDSKALAGL PGRVFLGKLP  180
EWTPDVRFFR SEEYPRVQHA QDCGVRGTLA IPVFEQGSKI CLGVIEVVMT TEMVKLRPEL  240
ESICRALQAV DLRSTEVPPI QPSLKGCDLS YKAALPEIQN LLRCACETHN LPLAQTWVSC  300
LQQTKTGCRH NDENYIHCIS TIDDACYVGD PTVLEFHEAC SEHHLLKGQG VAGQAFLTNG  360
PCFSPDVSNY KKSEYPLSHH ANMFGLHGAV AIRLRCVHTG SADFILEFFL PKECDDVEEQ  420
RKMLDALSSI MAHVPRSLRT VTDTELEEES EVIVTSKIEN TLVFDGGDEH NDVFGLKRGF  480
EYKSSESSMF FCDGFSSMAE KKRTKADKNI TLDVLRQYFA GSLKDAAKSI GVCPTTLKRI  540
CRQHGIQRWP SRKIKKVGHS LQKIKRVIDS VECVSGPLPI SSFYANFPNL ASREPSQQGK  600
TSPPLPQPLQ LSKSPVSTYS SSSSQCCSSG ATTDPSQGDV RTASSLDETV LTLSSLENNP  660
QGGTHLLSSS QDEDSLRIKV SYGEEKIRFR MRDSRRLTDL LWEIGKRFSI DDMSRYDLKY  720
LDEDNEWVLL TCDEDVEECV DVCRTTPSHT IMLLLHVSSH CFPERSSATG YSLWH
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Bra.181661e-116root
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY0910150.0AY091015.1 Arabidopsis thaliana putative nodule inception protein (At1g20640) mRNA, complete cds.
GenBankAY1172370.0AY117237.1 Arabidopsis thaliana putative nodule inception protein (At1g20640) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009103332.10.0PREDICTED: protein NLP4-like
SwissprotQ9LE380.0NLP4_ARATH; Protein NLP4
TrEMBLM4D6Y10.0M4D6Y1_BRARP; Uncharacterized protein
STRINGBra012241.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM34612663
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G20640.20.0Nin-like family protein